Structure of PDB 8csq Chain W

Receptor sequence

>8csqW (length=98) Species: 9606 (Homo sapiens)

VESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRR
PEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQE

3D structure

• PDB: 8csq Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: W
• Resolution: 2.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	W	H106 Y113	H30 Y37

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8csq, PDBe:8csq, PDBj:8csq
• PDBsum: 8csq
• PubMed: 36482135
• UniProt: Q9Y2Q9|RT28_HUMAN Small ribosomal subunit protein bS1m (Gene Name=MRPS28)