Structure of PDB 8auv Chain W

Receptor sequence

>8auvW (length=149) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

GRMHSRGKGISASALPYKRTPPSWLKISAPDVEDNICKFAKKGLTPSQIG
VILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKH
LERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLV

3D structure

PDB

8auv Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	G2 R3 M4 H5 R7 G8 K9 G10 I11 S12 A13 S14 A15 P17 R20 S48 G51 V52 R55 A61 Q62 K64 K70 L72 R73 K76 D87 H90 L91 K94 I98 H101 R104 N105 K107 D108 K109 D110 K112 F113 R114 I116 L117 S120 R121 R124 Y128	G1 R2 M3 H4 R6 G7 K8 G9 I10 S11 A12 S13 A14 P16 R19 S47 G50 V51 R54 A60 Q61 K63 K69 L71 R72 K75 D86 H89 L90 K93 I97 H100 R103 N104 K106 D107 K108 D109 K111 F112 R113 I115 L116 S119 R120 R123 Y127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8auv, PDBe:8auv, PDBj:8auv
PDBsum	8auv
PubMed	37156858
UniProt	A0A1S3ZRI7

[Back to BioLiP]