Structure of PDB 7zai Chain W

Receptor sequence
>7zaiW (length=61) Species: 29292 (Pyrococcus abyssi) [Search protein sequence]
RNVIPMPRSRFLRVKCIDCGNEQIVFSHPATRVRCNVCGATLVEPTGGKG
IIRAKILEVLE
3D structure
PDB7zai Role of aIF5B in archaeal translation initiation.
ChainW
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W P11 S13 A34 T50 G51 K53 P7 S9 A30 T46 G47 K49
BS02 ZN W C20 C23 C39 C42 C16 C19 C35 C38
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zai, PDBe:7zai, PDBj:7zai
PDBsum7zai
PubMed35694843
UniProtQ9UXZ3|RS27_PYRAB Small ribosomal subunit protein eS27 (Gene Name=rps27e)

[Back to BioLiP]