Structure of PDB 7ywx Chain W

Receptor sequence
>7ywxW (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLF
VHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
3D structure
PDB7ywx Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
ChainW
Resolution12.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna W M1 A2 M1 A2
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0007059 chromosome segregation
GO:0034080 CENP-A containing chromatin assembly
GO:0051276 chromosome organization
GO:0051301 cell division
GO:0051382 kinetochore assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000939 inner kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0016363 nuclear matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ywx, PDBe:7ywx, PDBj:7ywx
PDBsum7ywx
PubMed35420891
UniProtQ5EE01|CENPW_HUMAN Centromere protein W (Gene Name=CENPW)

[Back to BioLiP]