Structure of PDB 7vny Chain W

Receptor sequence
>7vnyW (length=54) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
MSKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAK
YNRV
3D structure
PDB7vny Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
ChainW
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO W F25 H32 F25 H32
BS02 BCL W H32 W43 H32 W43
BS03 SPO W F17 Q20 F23 L27 M30 F17 Q20 F23 L27 M30
BS04 BCL W L24 L27 A28 I31 H32 Y41 L24 L27 A28 I31 H32 Y41
BS05 SPO W F4 K6 F4 K6
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vny, PDBe:7vny, PDBj:7vny
PDBsum7vny
PubMed35418573
UniProtQ3J1A4|LHA1_CERS4 Light-harvesting protein B-875 alpha chain (Gene Name=pufA)

[Back to BioLiP]