Structure of PDB 7uxh Chain W

Receptor sequence
>7uxhW (length=281) Species: 9606 (Homo sapiens) [Search protein sequence]
SSKPRILLMGLRRSGKNSIQKVVFHKNSSFVNFQIWDFPYEMIFRGTGAL
IYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIE
TQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQL
PTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMID
VVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCI
LREESFERKGLIDYNFHCFRKAIHEVFEVGV
3D structure
PDB7uxh Structure of the lysosomal mTORC1-TFEB-Rag-Ragulator megacomplex.
ChainW
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP W R71 S72 G73 K74 N75 S76 K179 D181 I220 Y221 R13 S14 G15 K16 N17 S18 K89 D91 I130 Y131
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0043495 protein-membrane adaptor activity
GO:0046982 protein heterodimerization activity
GO:0051020 GTPase binding
GO:0060090 molecular adaptor activity
GO:0140767 enzyme-substrate adaptor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006915 apoptotic process
GO:0007264 small GTPase-mediated signal transduction
GO:0008104 protein localization
GO:0008380 RNA splicing
GO:0009267 cellular response to starvation
GO:0010507 negative regulation of autophagy
GO:0031669 cellular response to nutrient levels
GO:0032006 regulation of TOR signaling
GO:0034198 cellular response to amino acid starvation
GO:0043200 response to amino acid
GO:0061462 protein localization to lysosome
GO:0071230 cellular response to amino acid stimulus
GO:0072657 protein localization to membrane
GO:1903432 regulation of TORC1 signaling
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle
GO:1990131 Gtr1-Gtr2 GTPase complex
GO:1990877 FNIP-folliculin RagC/D GAP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uxh, PDBe:7uxh, PDBj:7uxh
PDBsum7uxh
PubMed36697823
UniProtQ9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C (Gene Name=RRAGC)

[Back to BioLiP]