Structure of PDB 7uvx Chain W

Receptor sequence

>7uvxW (length=78) Species: 480119 (Acinetobacter baumannii AB0057)

MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLR
LTTKGMRIIDKLGIEKVVADLRAQGQKI

3D structure

• PDB: 7uvx Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
• Chain: W
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	M1 S2 K3 K10 N16 S19 A21 N22 N23 K26 R27 F29 E30 P31 N32 H34 H36 R37 R50 T53 K54 R57 K61	M1 S2 K3 K10 N16 S19 A21 N22 N23 K26 R27 F29 E30 P31 N32 H34 H36 R37 R50 T53 K54 R57 K61
BS02	OI9	W	H20 N22	H20 N22

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 04:46:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7uvx', asym_id = 'W', title = 'Streptothricin F is a bactericidal antibiotic ef...eracts with the 30S subunit of the 70S ribosome. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7uvx', asym_id='W', title='Streptothricin F is a bactericidal antibiotic ef...eracts with the 30S subunit of the 70S ribosome. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7uvx', asym_id = 'W'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7uvx', asym_id='W')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>