Structure of PDB 7u0h Chain W

Receptor sequence

>7u0hW (length=232) Species: 1247190 (Saccharomyces cerevisiae BY4741)

RSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYRYVWVLHLDDVRTPV
LQEIRTSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGL
LFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAE
EDVPMIHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALI
LKQFGIAASEFKVKVSAYYDNDSSTVESTNIN

3D structure

• PDB: 7u0h Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
• Chain: W
• Resolution: 2.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	R3 S4 K5 R6 S7 A13 T15 D16 K17 K18 R20 N22 E24 R25 F27 D47 R49 T50 L53 Q54 R57 M67 G68 K69 R70 K71 V72 K75 I158 H159 S160 L161	R1 S2 K3 R4 S5 A11 T13 D14 K15 K16 R18 N20 E22 R23 F25 D45 R47 T48 L51 Q52 R55 M65 G66 K67 R68 K69 V70 K73 I156 H157 S158 L159

Gene Ontology

Molecular Function

• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0000055 ribosomal large subunit export from nucleus
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:0032040 small-subunit processome

External links

• PDB: RCSB:7u0h, PDBe:7u0h, PDBj:7u0h
• PDBsum: 7u0h
• PubMed: 36482249
• UniProt: P33201|MRT4_YEAST Ribosome assembly factor MRT4 (Gene Name=MRT4)