Structure of PDB 7ryg Chain W

Receptor sequence

>7rygW (length=77) Species: 480119 (Acinetobacter baumannii AB0057)

SKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRL
TTKGMRIIDKLGIEKVVADLRAQGQKI

3D structure

• PDB: 7ryg An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
• Chain: W
• Resolution: 2.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	S2 K3 K10 N16 S19 A21 N22 N23 K24 K26 R27 R28 F29 E30 P31 N32 H34 H36 R37 R50 T53 K54 R57 K61	S1 K2 K9 N15 S18 A20 N21 N22 K23 K25 R26 R27 F28 E29 P30 N31 H33 H35 R36 R49 T52 K53 R56 K60

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Apr 17 13:43:26 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ryg', asym_id = 'W', title = 'An Analysis of the Novel Fluorocycline TP-6076 B...g Efflux Pump AdeJ from Acinetobacter baumannii. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ryg', asym_id='W', title='An Analysis of the Novel Fluorocycline TP-6076 B...g Efflux Pump AdeJ from Acinetobacter baumannii. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7ryg', asym_id = 'W'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7ryg', asym_id='W')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>