Structure of PDB 7qv2 Chain W

Receptor sequence

>7qv2W (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV

3D structure

• PDB: 7qv2 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
• Chain: W
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	R79 G81 R82	R69 G71 R72
BS02	rna	W	S11 K12 N20 R22 D23 S24 E25 A26 K27 R28 K32 R33 A34 D35 Q37 G41 G42 S43 I44 Y46 R47 R49 T51 K52 Y54 G62 G63 D64 D65 F68 F77 K85	S1 K2 N10 R12 D13 S14 E15 A16 K17 R18 K22 R23 A24 D25 Q27 G31 G32 S33 I34 Y36 R37 R39 T41 K42 Y44 G52 G53 D54 D55 F58 F67 K75

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qv2, PDBe:7qv2, PDBj:7qv2
• PDBsum: 7qv2
• PubMed: 35264791
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)