Structure of PDB 7qv1 Chain W

Receptor sequence
>7qv1W (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV
3D structure
PDB7qv1 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
ChainW
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W G81 R82 G71 R72
BS02 rna W S11 K12 N20 R22 D23 S24 E25 A26 K27 R28 L29 K32 A34 Q37 G41 G42 I44 R47 R49 T51 Y54 G63 D64 D65 F77 F80 R84 K85 S1 K2 N10 R12 D13 S14 E15 A16 K17 R18 L19 K22 A24 Q27 G31 G32 I34 R37 R39 T41 Y44 G53 D54 D55 F67 F70 R74 K75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qv1, PDBe:7qv1, PDBj:7qv1
PDBsum7qv1
PubMed35264791
UniProtP05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]