Structure of PDB 7qi5 Chain W

Receptor sequence

>7qi5W (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]

KKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVG
VGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVH
VVPAKPEGTFKLVAML

3D structure

PDB

7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

Chain

Resolution

2.63 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	K33 S35	K1 S3
BS02	rna	W	S38 S39 N41 L42 G43 G44 S46 S47 G48 R49 R50 I53 K54 M56 E57 H59 A63 G64 N65 I66 R71 R74 W75 G84 K85 N86 Y99 K101 H107 R109 T129	S6 S7 N9 L10 G11 G12 S14 S15 G16 R17 R18 I21 K22 M24 E25 H27 A31 G32 N33 I34 R39 R42 W43 G52 K53 N54 Y67 K69 H75 R77 T97

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum	7qi5
PubMed	38769321
UniProt	Q9P0M9\|RM27_HUMAN Large ribosomal subunit protein bL27m (Gene Name=MRPL27)