Structure of PDB 7qh7 Chain W

Receptor sequence
>7qh7W (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
RRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVR
YTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
3D structure
PDB7qh7 A late-stage assembly checkpoint of the human mitochondrial ribosome large subunit.
ChainW
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide W K101 R119 L126 K53 R71 L78
BS02 rna W R49 R50 K54 M56 E57 H59 A63 G64 N65 I66 R74 W75 K85 Y90 Y99 K101 R1 R2 K6 M8 E9 H11 A15 G16 N17 I18 R26 W27 K37 Y42 Y51 K53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qh7, PDBe:7qh7, PDBj:7qh7
PDBsum7qh7
PubMed35177605
UniProtQ9P0M9|RM27_HUMAN Large ribosomal subunit protein bL27m (Gene Name=MRPL27)

[Back to BioLiP]