Structure of PDB 7psa Chain W

Receptor sequence

>7psaW (length=114) Species: 10090 (Mus musculus)

TSVKPIFSRDLNEAKRRVRELYRAWYREVPNTVHLMQLDITVKQGRDKVR
EMFMKNAHVTDPRVVDLLVIKGKMELQETIKVWKQRTHVMRFFHETETPR
PKDFLSKFYMGHDP

3D structure

• PDB: 7psa Cryo-electron microscopy reveals how acetogenins inhibit mitochondrial respiratory complex I.
• Chain: W
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EHZ	W	V34 W41 M68 F69 N72 A73 L84	V18 W25 M52 F53 N56 A57 L68

Gene Ontology

Molecular Function

• GO:0003674 molecular_function

Biological Process

• GO:0009060 aerobic respiration
• GO:0032981 mitochondrial respiratory chain complex I assembly
• GO:0042776 proton motive force-driven mitochondrial ATP synthesis

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0031966 mitochondrial membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7psa, PDBe:7psa, PDBj:7psa
• PDBsum: 7psa
• PubMed: 35063503
• UniProt: Q9CQZ5|NDUA6_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (Gene Name=Ndufa6)