Structure of PDB 7ohy Chain W

Receptor sequence
>7ohyW (length=227) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RSKRSAQTDKKGRENKERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIR
TSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGLLFTDE
DVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAEEDVPM
IHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALILKQFG
IAASEFKVKVSAYYDNDSSTVESTNIN
3D structure
PDB7ohy Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
ChainW
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W R3 S4 K5 R6 S7 A13 T15 D16 K17 K18 R20 I26 D47 R49 T50 Q54 R57 M67 K69 R70 K71 K75 S160 K204 Q205 R1 S2 K3 R4 S5 A6 T8 D9 K10 K11 R13 I19 D40 R42 T43 Q47 R50 M60 K62 R63 K64 K68 S153 K197 Q198
Gene Ontology
Molecular Function
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor
GO:0032040 small-subunit processome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohy, PDBe:7ohy, PDBj:7ohy
PDBsum7ohy
PubMed34813592
UniProtP33201|MRT4_YEAST Ribosome assembly factor MRT4 (Gene Name=MRT4)

[Back to BioLiP]