Structure of PDB 7nhm Chain W

Receptor sequence
>7nhmW (length=89) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVA
SVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
3D structure
PDB7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
ChainW
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W T13 E14 K15 K24 N34 K35 T36 Q37 K39 N54 I55 M56 N57 Y58 K59 K61 K63 R64 M65 R67 Y68 Q69 G70 N73 K74 R76 K77 I79 T12 E13 K14 K23 N33 K34 T35 Q36 K38 N53 I54 M55 N56 Y57 K58 K60 K62 R63 M64 R66 Y67 Q68 G69 N72 K73 R75 K76 I78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
PDBsum7nhm
PubMed34117249
UniProtQ2FW08|RL23_STAA8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]