Structure of PDB 7boi Chain W

Receptor sequence

>7boiW (length=314) Species: 83333 (Escherichia coli K-12)

NLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRP
GKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAIL
PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNI
GYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKE
ILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQI
TQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRIL
ESMAQVKTRKNFSD

3D structure

• PDB: 7boi A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit.
• Chain: W
• Resolution: 2.98 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	F48 G49 M50 H51 R63 I66 R67 R68 T69 R109 Y113 K117 E135 I140 N242 L245 Q247 H248 T251 P268 G269 R271 E272 K343 N344	F15 G16 M17 H18 R30 I33 R34 R35 T36 R76 Y80 K84 E102 I107 N209 L212 Q214 H215 T218 P235 G236 R238 E239 K310 N311
BS02	ZN	W	C297 H304 C310	C264 H271 C277
BS03	GNP	W	K161 D163 S192 H193 S216 G217 V218 G219 K220 S221 S222 I239 S240 T249 T250 G269	K128 D130 S159 H160 S183 G184 V185 G186 K187 S188 S189 I206 S207 T216 T217 G236
BS04	MG	W	S221 T250	S188 T217
BS05	MG	W	D111 D114	D78 D81

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0019003 GDP binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7boi, PDBe:7boi, PDBj:7boi
• PDBsum: 7boi
• PubMed: 34088665
• UniProt: P39286|RSGA_ECOLI Small ribosomal subunit biogenesis GTPase RsgA (Gene Name=rsgA)