Structure of PDB 6ywv Chain W

Receptor sequence
>6ywvW (length=59) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]
AVPKKKTSHMKKRHRQMAGKALKDVTHLNRCPACGNLKRMHHLCSTCLGK
LKGFMDRNG
3D structure
PDB6ywv Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
ChainW
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W A64 V65 P66 K67 K68 K69 T70 S71 H72 M73 K74 K75 R76 H77 R78 Q79 M80 A81 K83 T89 H90 N92 R93 P95 M103 H104 G112 R120 A1 V2 P3 K4 K5 K6 T7 S8 H9 M10 K11 K12 R13 H14 R15 Q16 M17 A18 K20 T26 H27 N29 R30 P32 M40 H41 G49 R57
BS02 ZN W C94 C97 C107 C110 C31 C34 C44 C47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ywv, PDBe:6ywv, PDBj:6ywv
PDBsum6ywv
PubMed33056988
UniProtQ1K4P1|RM32_NEUCR Large ribosomal subunit protein bL32m (Gene Name=mrpl32)

[Back to BioLiP]