Structure of PDB 6y7c Chain W

Receptor sequence
>6y7cW (length=129) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFV
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY
3D structure
PDB6y7c Good Vibrations: Structural Remodeling of Maturing Yeast Pre-40S Ribosomal Particles Followed by Cryo-Electron Microscopy.
ChainW
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W S4 A8 N16 K19 R28 S30 S31 K32 R57 K71 V74 I75 S76 N80 K82 I83 W89 L93 T105 T106 S107 H120 S122 F128 Y130 S3 A7 N15 K18 R27 S29 S30 K31 R56 K70 V73 I74 S75 N79 K81 I82 W88 L92 T104 T105 S106 H119 S121 F127 Y129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y7c, PDBe:6y7c, PDBj:6y7c
PDBsum6y7c
PubMed32138239
UniProtP0C0W1|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)

[Back to BioLiP]