Structure of PDB 6swd Chain W

Receptor sequence
>6swdW (length=63) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
ALPRNVIPMPRSRFLRVKCIDCGNEQIVFSHPATRVRCNVCGATLVEPTG
GKGIIRAKILEVL
3D structure
PDB6swd Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
ChainW
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W P11 R12 S13 A34 G51 G52 K53 P10 R11 S12 A33 G50 G51 K52
BS02 ZN W C20 C23 C39 C19 C22 C38
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swd, PDBe:6swd, PDBj:6swd
PDBsum6swd
PubMed32029867
UniProtQ9UXZ3|RS27_PYRAB Small ribosomal subunit protein eS27 (Gene Name=rps27e)

[Back to BioLiP]