Structure of PDB 6htq Chain W

Receptor sequence

>6htqW (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

RKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSAR
ALKSGKVE

3D structure

PDB

6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.

Chain

Resolution

4.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	K4 C5 V6 I7 T8 G9 T12 T13 A14 G15 N16 N17 R18 S19 H20 A21 N23 A24 S25 K26 R27 T28 W29 N32 L33 Q34 K35 V36 R37 I38 L39 V40 N41 G42 K43 P44 K45 K46 V49 S50 A51 R52 A53 L54 K55 S56 G57 K58 V59 E60	K2 C3 V4 I5 T6 G7 T10 T11 A12 G13 N14 N15 R16 S17 H18 A19 N21 A22 S23 K24 R25 T26 W27 N30 L31 Q32 K33 V34 R35 I36 L37 V38 N39 G40 K41 P42 K43 K44 V47 S48 A49 R50 A51 L52 K53 S54 G55 K56 V57 E58

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6htq, PDBe:6htq, PDBj:6htq
PDBsum	6htq
PubMed	32937119
UniProt	P37807\|RL28_BACSU Large ribosomal subunit protein bL28 (Gene Name=rpmB)