Structure of PDB 6fyy Chain W

Receptor sequence

>6fyyW (length=129) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGY
VILTTSAGIMDHEEAHRKHVSGKILGFVY

3D structure

• PDB: 6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
• Chain: W
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	T2 R3 T4 S5 V6 A8 N12 N16 K19 T20 K22 R28 S30 S31 K32 H56 R57 S58 K60 K71 V74 I75 S76 R78 N80 V81 K82 I83 K88 W89 L93 T105 T106 S107 I110 E115 R118 K119 H120 S122 Y130	T1 R2 T3 S4 V5 A7 N11 N15 K18 T19 K21 R27 S29 S30 K31 H55 R56 S57 K59 K70 V73 I74 S75 R77 N79 V80 K81 I82 K87 W88 L92 T104 T105 S106 I109 E114 R117 K118 H119 S121 Y129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
• PDBsum: 6fyy
• PubMed: 30475211
• UniProt: Q6CW21|RS22_KLULA Small ribosomal subunit protein uS8 (Gene Name=RPS22)