Structure of PDB 5mre Chain W

Receptor sequence

>5mreW (length=112) Species: 4932 (Saccharomyces cerevisiae)

AVPKKKVSHQKKRQKLYGPGKKQLKMIHHLNKCPSCGHYKRANTLCMYCV
GQISHIWKTHTAKEEIKPRQEEELSELDQRVLYPGRRDTKYTKDLKDKDN
YLERRVRTLKKD

3D structure

• PDB: 5mre The structure of the yeast mitochondrial ribosome.
• Chain: W
• Resolution: 3.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	A72 V73 P74 K75 K76 K77 V78 S79 H80 Q81 K82 K83 R84 Q85 K86 L87 Y88 G89 P90 K92 K93 Q94 H99 H100 N102 K103 P105 K111 N114 G122 Q123 H126 K129 G156 R157 R158 T160 K169 D170 L173 E174 R175 R176	A1 V2 P3 K4 K5 K6 V7 S8 H9 Q10 K11 K12 R13 Q14 K15 L16 Y17 G18 P19 K21 K22 Q23 H28 H29 N31 K32 P34 K40 N43 G51 Q52 H55 K58 G85 R86 R87 T89 K98 D99 L102 E103 R104 R105
BS02	ZN	W	C104 C107 C117 C120	C33 C36 C46 C49

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0015934 large ribosomal subunit

External links

• PDB: RCSB:5mre, PDBe:5mre, PDBj:5mre
• PDBsum: 5mre
• PubMed: 28154081
• UniProt: P25348|RM32_YEAST Large ribosomal subunit protein bL32m (Gene Name=MRPL32)