Structure of PDB 5dm7 Chain W

Receptor sequence
>5dm7W (length=55) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHL
LEVQE
3D structure
PDB5dm7 Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
ChainW
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W S8 I10 G11 R12 K18 T19 A22 L23 R26 I28 S35 T37 A39 V40 G42 M43 T46 S8 I10 G11 R12 K18 T19 A22 L23 R26 I28 S35 T37 A39 V40 G42 M43 T46
BS02 rna W R12 H49 R12 H49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dm7, PDBe:5dm7, PDBj:5dm7
PDBsum5dm7
PubMed26464437
UniProtQ9RSL0|RL30_DEIRA Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]