Structure of PDB 4wf9 Chain W

Receptor sequence
>4wf9W (length=58) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKV
KHLVTVEE
3D structure
PDB4wf9 Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
ChainW
Resolution3.427 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W R10 S11 I13 G14 P16 E17 R20 K21 T22 A25 K30 T31 N32 A42 G45 Q46 K49 R10 S11 I13 G14 P16 E17 R20 K21 T22 A25 K30 T31 N32 A42 G45 Q46 K49
BS02 rna W Q19 H52 Q19 H52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wf9, PDBe:4wf9, PDBj:4wf9
PDBsum4wf9
PubMed26464510
UniProtP0A0G2|RL30_STAA8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]