Structure of PDB 4ioa Chain W

Receptor sequence
>4ioaW (length=55) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHL
LEVQE
3D structure
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainW
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W R7 S8 I10 G11 G14 N15 K18 T19 A22 R26 K27 I28 R32 S35 T37 P38 A39 G42 M43 T46 R7 S8 I10 G11 G14 N15 K18 T19 A22 R26 K27 I28 R32 S35 T37 P38 A39 G42 M43 T46
BS02 rna W R12 Q16 H49 R12 Q16 H49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RSL0|RL30_DEIRA Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]