Structure of PDB 3wmm Chain W

Receptor sequence

>3wmmW (length=60) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]

FTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNI
PVSYQALGKK

3D structure

PDB

3wmm Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom

Chain

Resolution

3.008 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CRT	W	G32 L33 H36 M37	G31 L32 H35 M36
BS02	CA	W	W46 D49 N50 I51	W45 D48 N49 I50
BS03	BCL	W	Q28 H36 W46	Q27 H35 W45
BS04	BCL	W	Q28 L31 G32 I35 H36	Q27 L30 G31 I34 H35
BS05	CRT	W	I24 Q28 L31 L34 I35	I23 Q27 L30 L33 I34

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

External links