Structure of PDB 3pio Chain W

Receptor sequence
>3pioW (length=55) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHL
LEVQE
3D structure
PDB3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
ChainW
Resolution3.2473 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W R7 S8 I10 R12 K18 T19 Q21 A22 R26 I28 A39 R7 S8 I10 R12 K18 T19 Q21 A22 R26 I28 A39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum3pio
PubMed21282615
UniProtQ9RSL0|RL30_DEIRA Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]