Structure of PDB 3j7y Chain W

Receptor sequence
>3j7yW (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
LGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYA
LEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGT
FKLVAML
3D structure
PDB3j7y Structure of the large ribosomal subunit from human mitochondria.
ChainW
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W G44 S46 G48 R49 R50 I53 K54 M56 E57 H59 A63 G64 N65 I66 R71 R74 W75 G84 K85 N86 Y90 Y99 G3 S5 G7 R8 R9 I12 K13 M15 E16 H18 A22 G23 N24 I25 R30 R33 W34 G43 K44 N45 Y49 Y58
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7y, PDBe:3j7y, PDBj:3j7y
PDBsum3j7y
PubMed25278503
UniProtQ9P0M9|RM27_HUMAN Large ribosomal subunit protein bL27m (Gene Name=MRPL27)

[Back to BioLiP]