Structure of PDB 3j6b Chain W

Receptor sequence

>3j6bW (length=112) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AVPKKKVSHQKKRQKLYGPGKKQLKMIHHLNKCPSCGHYKRANTLCMYCV
GQISHIWKTHTAKEEIKPRQEEELSELDQRVLYPGRRDTKYTKDLKDKDN
YLERRVRTLKKD

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	A72 V73 P74 K75 K76 K77 V78 S79 H80 Q81 K82 K83 R84 Q85 K86 L87 Y88 G89 P90 K92 K93 Q94 H99 H100 N102 K103 P105 K111 N114 G122 Q123 H126 K129 G156 R157 R158 T160 K169 L173 R175 R176	A1 V2 P3 K4 K5 K6 V7 S8 H9 Q10 K11 K12 R13 Q14 K15 L16 Y17 G18 P19 K21 K22 Q23 H28 H29 N31 K32 P34 K40 N43 G51 Q52 H55 K58 G85 R86 R87 T89 K98 L102 R104 R105
BS02	ZN	W	C104 C117	C33 C46

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P25348\|RM32_YEAST Large ribosomal subunit protein bL32m (Gene Name=MRPL32)