Structure of PDB 2j37 Chain W

Receptor sequence

>2j37W (length=479) Species: 9616 (Canis sp.)

RKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVK
SAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGNVIMFVGL
QGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPF
YGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVA
NAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGA
LSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNE
LKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDF
MSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARG
SGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLN
QQMAKMMDPRVLHHMGGMAGLQSMMRQFQ

3D structure

• PDB: 2j37 Following the signal sequence from ribosomal tunnel exit to signal recognition particle.
• Chain: W
• Resolution: 8.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	W	T377 D380 S381 N383 R402 R405 R408 G409 S410 G411	T368 D371 S372 N374 R393 R396 R399 G400 S401 G402
BS02	peptide	W	I339 G350 M351 I352 P353 G354 F355 G356 D358 S361 R371 Q423 K426 F427 M430 K433 M477 A478 G479	I330 G341 M342 I343 P344 G345 F346 G347 D349 S352 R362 Q414 K417 F418 M421 K424 M468 A469 G470
BS03	rna	W	A393 K394 S397 Q488	A384 K385 S388 Q479

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0008312 7S RNA binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0019003 GDP binding
• GO:0030942 endoplasmic reticulum signal peptide binding

Biological Process

• GO:0006614 SRP-dependent cotranslational protein targeting to membrane
• GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
• GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
• GO:0030593 neutrophil chemotaxis
• GO:0030851 granulocyte differentiation
• GO:0031017 exocrine pancreas development
• GO:0045047 protein targeting to ER

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005786 signal recognition particle, endoplasmic reticulum targeting
• GO:0005829 cytosol
• GO:0016607 nuclear speck
• GO:0048500 signal recognition particle

External links

• PDB: RCSB:2j37, PDBe:2j37, PDBj:2j37
• PDBsum: 2j37
• PubMed: 17086193
• UniProt: P61010|SRP54_CANLF Signal recognition particle subunit SRP54 (Gene Name=SRP54)