Structure of PDB 1q81 Chain W

Receptor sequence
>1q81W (length=65) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELR
KAIARIKTIQGEEGD
3D structure
PDB1q81 Structural Insights into Peptide Bond Formation
ChainW
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna W T1 H4 V5 Q6 E7 R9 Q34 P43 G44 R50 K51 A54 R55 K57 T58 E62 T1 H4 V5 Q6 E7 R9 Q34 P43 G44 R50 K51 A54 R55 K57 T58 E62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1q81, PDBe:1q81, PDBj:1q81
PDBsum1q81
PubMed12185246
UniProtP10971|RL29_HALMA Large ribosomal subunit protein uL29 (Gene Name=rpl29)

[Back to BioLiP]