Structure of PDB 5jup Chain VB

Receptor sequence

>5jupVB (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD

3D structure

PDB

5jup Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	VB	R8 T9 R10 K11 V12 A33 N34 V35 S36 K37 Y48 G59 F60 R61 T62 Q63 F64 G65 G66 Y89 R93 K102 R105 Q106 R108 K109 K112 N113 K116 K117 F119 G120 T121 K123 R124 K127 K128 D135	R7 T8 R9 K10 V11 A32 N33 V34 S35 K36 Y47 G58 F59 R60 T61 Q62 F63 G64 G65 Y88 R92 K101 R104 Q105 R107 K108 K111 N112 K115 K116 F118 G119 T120 K122 R123 K126 K127 D134

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5jup, PDBe:5jup, PDBj:5jup
PDBsum	5jup
PubMed	27159452
UniProt	P0CX31\|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)