Structure of PDB 7r81 Chain V2

Receptor sequence
>7r81V2 (length=99) Species: 5141 (Neurospora crassa) [Search protein sequence]
HRVRITLTSRKVQALEKVCSELVERAKTKDLRVKGPVRLPTKILKITTRK
SPCGEGSKTWDLFEMRIHKRLIDLTAPTEIVKQIIVNIEAGVEVEVTIA
3D structure
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
ChainV2
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V2 R21 E33 K51 G52 R55 L56 P57 T58 T64 R66 C70 G71 E72 G73 S74 K75 T76 W77 R83 H85 K86 R87 L88 R4 E16 K34 G35 R38 L39 P40 T41 T47 R49 C53 G54 E55 G56 S57 K58 T59 W60 R66 H68 K69 R70 L71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7S3G1

[Back to BioLiP]