Structure of PDB 6gzx Chain V2

Receptor sequence

>6gzxV2 (length=77) Species: 300852 (Thermus thermophilus HB8)

STRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFT
LFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: V2
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V2	S9 T10 R11 N12 R14 D15 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 R32 I36 R41 G42 T43 R44 F45 G54 R55 D56 F57 F60 L62 F69 L75 R77	S1 T2 R3 N4 R6 D7 Q9 A10 K11 R12 K16 R17 Y18 E19 Q21 R24 I28 R33 G34 T35 R36 F37 G46 R47 D48 F49 F52 L54 F61 L67 R69
BS02	rna	V2	R72 R74	R64 R66

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)