Structure of PDB 8j9j Chain V1

Receptor sequence

>8j9jV1 (length=504) Species: 3039 (Euglena gracilis)

SIIQVPDKAPKTPAGFLQDKDRIFQNIYNDHGQGLKNAQKLGDWYRTKDL
LAKGPEWIIDQIKKSGLRGRGGAGFPSGLKWSFMPKKPPADGRPSYVVIN
ADESEPGTCKDREIMRMEPHKLVEGTLIAGFAMRARAAYIYVRGEFYNET
LSVEKAIKEAYDAGLLGDNACGSGYKFDIVLCRGAGAYICGEETGLIESL
EGKSGKPRLKPPFPANIGLWGCPTIVTNVETVSVSPTILRRGPEWFASFG
RKNNSGTKLFCISGHVNTPCTVEESMSIPLRELLEKHCGGVRGGWDNLLA
VIPGGSSVPVLPKSICDDVLMDFDALMDEGSALGTAAVIVMDKSTDLIKA
LARISMFYKNESCNQCTPCREGAGVMANIMDRIWKGNGFGPEVDMIKDIA
DNVELRSICALGAAAAWPIQGLHKHFREEMIQRIEDFTDISYNLHKDEMF
GHGAAFDWRRTPKTFHGTLDSFQDSTYRPPAANNNAYRGQYPHVPIYEKE
KSEA

3D structure

• PDB: 8j9j Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism.
• Chain: V1
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	V1	G86 G88 K97 N117 D119 E120 Y205 G208 E209 T244 N245 T248 A427 L428	G69 G71 K80 N100 D102 E103 Y188 G191 E192 T227 N228 T231 A410 L411
BS02	SF4	V1	I206 P224 S379 C380 N381 Q382 C383 C386 S424 I425 C426 L428	I189 P207 S362 C363 N364 Q365 C366 C369 S407 I408 C409 L411
BS03	NAI	V1	G88 G89 A90 F92 K97 E122 Y205 E210 F230 T352	G71 G72 A73 F75 K80 E105 Y188 E193 F213 T335

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 04:37:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8j9j', asym_id = 'V1', title = "Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. "

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8j9j', asym_id='V1', title="Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. ")

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0010181,0051287,0051539', uniprot = '', pdbid = '8j9j', asym_id = 'V1'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0010181,0051287,0051539', uniprot='', pdbid='8j9j', asym_id='V1')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>