Structure of PDB 8esz Chain V1

Receptor sequence

>8eszV1 (length=438) Species: 7227 (Drosophila melanogaster)

GTPPPQTKTKFGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLK
GADWIVNEIKTSGLRGRGGAGFPSGMKWSFMNKPGDGRPKYLVVNADEGE
PGTCKDREIMRHDPHKLVEGCLIAGRAMGAQAAYIYIRGEFYNEASNMQL
AIAEAYQAGLIGKNACGTGYDFDVFMHRGAGAYICGEETALIESLEGKQG
KPRLKPPFPADVGVFGCPTTVTNVETVAVAPTICRRGGVWFASFGRTRNS
GTKLFNISGHVNRPCTVEEEMSIPLKELIERHCGGVTGGWDNLLGVIPGG
SSTPIIPKNVCDDVIMDFDGLIAAQTSLGTAAIIVMDKSTDVIKAIARLI
SFYKHESCGQCTPCREGIGWMNKIMTRFVKGDAQPAEIDMLWEISKQIEG
HTICALGDGAAWPVQGLIRHFRPEIEKRMQLHAKRVSN

3D structure

• PDB: 8esz Resting mitochondrial complex I from Drosophila melanogaster adopts a helix-locked state.
• Chain: V1
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	V1	R147 Y178 N179 Y192 K199 D209	R111 Y142 N143 Y156 K163 D173
BS02	FMN	V1	G102 G104 K113 N131 D133 E134 Y219 G222 E223 N259 A441 L442	G66 G68 K77 N95 D97 E98 Y183 G186 E187 N223 A405 L406
BS03	SF4	V1	I220 P238 C394 G395 Q396 C397 C400 T438 I439 C440	I184 P202 C358 G359 Q360 C361 C364 T402 I403 C404

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:8esz, PDBe:8esz, PDBj:8esz
• PDBsum: 8esz
• PubMed: 36952377
• UniProt: Q9VMI3