Structure of PDB 7r81 Chain V1

Receptor sequence

>7r81V1 (length=159) Species: 5141 (Neurospora crassa) [Search protein sequence]

GHAAGLRAGTRYAFSRNFREKGMIRLSTYLKQYKVGDIVDIKVNGAVQKG
MAHKVYHGKTGVIYNVTKSAVGIIIYKKVKHRYIEKRINVRIEHIQPSRS
RDDFLRRVKQNAELKKQAKAEGKPVQLKRQALLPREARTISVVDNKPETV
APVAYETTI

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V1	A4 A5 G6 L7 R8 A9 G10 R12 Y13 A14 S16 R17 F19 K22 G23 K35 K43 G46 A47 Q49 K50 G51 H54 Y57 H58 G59 K60 T61 S70 A71 K78 V80 H82 R83 K87 R88 I89 N90 R100 S101 R102 D104 F105 R108 V109 K116 K120 V126 Q127 K129 R130	A3 A4 G5 L6 R7 A8 G9 R11 Y12 A13 S15 R16 F18 K21 G22 K34 K42 G45 A46 Q48 K49 G50 H53 Y56 H57 G58 K59 T60 S69 A70 K77 V79 H81 R82 K86 R87 I88 N89 R99 S100 R101 D103 F104 R107 V108 K115 K119 V125 Q126 K128 R129
BS02	rna	V1	R20 R26 S28	R19 R25 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q7SDY8

[Back to BioLiP]