Structure of PDB 8xz3 Chain V

Receptor sequence
>8xz3V (length=97) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
MKVHKGDTVLVISGKDKGAKGKVLVAYPDRNKVLVEGVNRIKKHTAVSGG
IVTQEAPIHVSNVMVVDSDGKPTRVGYRIDDETGKKVRIAKTNGKDI
3D structure
PDB8xz3 Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.
ChainV
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V K2 H4 K5 I12 G14 K17 P28 I41 K42 K43 H44 A46 G57 I59 H67 S69 N70 P80 R82 K94 K2 H4 K5 I12 G14 K17 P28 I41 K42 K43 H44 A46 G49 I51 H59 S61 N62 P72 R74 K86
Gene Ontology
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xz3, PDBe:8xz3, PDBj:8xz3
PDBsum8xz3
PubMed39029461
UniProtA0QSG0|RL24_MYCS2 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]