Structure of PDB 8x1c Chain V

Receptor sequence

>8x1cV (length=204) Species: 9606 (Homo sapiens)

KRPEGMHREVYALLYSDKKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEG
KDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRF
VVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAG
HERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKL
ITAA

3D structure

• PDB: 8x1c Structure of nucleosome-bound SRCAP-C in the ADP-bound state
• Chain: V
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	V	R49 R55	R2 R8

Gene Ontology

Molecular Function

• GO:0003714 transcription corepressor activity
• GO:0005515 protein binding
• GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006281 DNA repair
• GO:0006325 chromatin organization
• GO:0006338 chromatin remodeling
• GO:0006355 regulation of DNA-templated transcription
• GO:0042307 positive regulation of protein import into nucleus
• GO:0042981 regulation of apoptotic process
• GO:0045471 response to ethanol
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription
• GO:0051726 regulation of cell cycle
• GO:1905168 positive regulation of double-strand break repair via homologous recombination
• GO:2000779 regulation of double-strand break repair

Cellular Component

• GO:0000786 nucleosome
• GO:0000812 Swr1 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005657 replication fork
• GO:0005694 chromosome
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0035267 NuA4 histone acetyltransferase complex

External links

• PDB: RCSB:8x1c, PDBe:8x1c, PDBj:8x1c
• PDBsum: 8x1c
• PubMed: 38331872
• UniProt: Q9NPF5|DMAP1_HUMAN DNA methyltransferase 1-associated protein 1 (Gene Name=DMAP1)