Structure of PDB 8wk4 Chain V |
>8wk4V (length=164) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
DLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT EEHYSPNGDASKATLRSRQLNISEQVGAGPRSTQRNETSNYEVDRTIRHT KMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDK RGDTLNVVNSPFSA |
|
PDB | 8wk4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. |
Chain | V |
Resolution | 3.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
V |
R294 S295 Q297 |
R66 S67 Q69 |
|
|
|