Structure of PDB 8uua Chain V

Receptor sequence

>8uuaV (length=90) Species: 1642 (Listeria innocua) [Search protein sequence]

DARDIIKRPVVTEESTSILDDKKYTFEVDTRATKTQVKYAIEEIFDVKVA
KVNVMNYKGKLKRMGRYAGYTNKRRKAIVTVTADSKEIQF

3D structure

PDB

8uua Mechanistic insights into the alternative ribosome recycling by HflXr.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	T13 K24 T34 K35 Y40 K52 N54 M56 N57 Y58 K59 K61 M65 Y68 G70 N73 R76	T12 K23 T33 K34 Y39 K51 N53 M55 N56 Y57 K58 K60 M64 Y67 G69 N72 R75
BS02	MG	V	N57 Y58	N56 Y57

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links