Structure of PDB 8ury Chain V

Receptor sequence
>8uryV (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB8ury Structural basis of RfaH-mediated transcription-translation coupling
ChainV
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V R6 K16 M17 E18 K19 F28 I33 Y34 K36 F37 K39 R40 T41 T42 K43 H45 E63 R65 P66 L67 S68 K69 T70 K71 S72 R3 K13 M14 E15 K16 F25 I30 Y31 K33 F34 K36 R37 T38 T39 K40 H42 E60 R62 P63 L64 S65 K66 T67 K68 S69
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ury, PDBe:8ury, PDBj:8ury
PDBsum8ury
PubMed39117885
UniProtC3SQY7

[Back to BioLiP]