Structure of PDB 8uri Chain V

Receptor sequence
>8uriV (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB8uri Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
ChainV
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V R6 K16 M17 E18 K19 F28 I33 Y34 K36 F37 K39 R40 T41 T42 K43 H45 E63 R65 P66 L67 S68 K69 T70 K71 S72 R3 K13 M14 E15 K16 F25 I30 Y31 K33 F34 K36 R37 T38 T39 K40 H42 E60 R62 P63 L64 S65 K66 T67 K68 S69
External links