Structure of PDB 8rw1 Chain V |
>8rw1V (length=87) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] |
MENDKGQLVELYVPRKCSATNRIIKAKDHSSVQINIAQVDEEGRAIPGEY VTYALSGYIRARGEADDSLNRLAQQDGLLKNVWSYSR |
|
PDB | 8rw1 Structural basis of AUC codon discrimination during translation initiation in yeast. |
Chain | V |
Resolution | 3.35 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
V |
Y58 R62 |
Y58 R62 |
|
|
|