Structure of PDB 8ovj Chain V

Receptor sequence

>8ovjV (length=118) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

RKSYTRPQFRRPHTYRKPAMAKPSNRVTVESKDIAAFNVIRYPLTTDKAM
KKIEENNTLTFIVDSRANKTEIKKAMRKLYQVKAVKVNTLIRPDGLKKAY
IRLSAAHDALDTANKIGL

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	V	R32 R36 R37 P38 H39 T40 R42 K43 K48 T72 K74 N82 K95 K112 N114 T115 P119 Y126 R128	R6 R10 R11 P12 H13 T14 R16 K17 K22 T46 K48 N56 K69 K86 N88 T89 P93 Y100 R102
BS02	rna	V	R27 Y30 Y41 R52 S91 R92 N94 R103 K109	R1 Y4 Y15 R26 S65 R66 N68 R77 K83
BS03	rna	V	P33 Q34 N94 K95	P7 Q8 N68 K69

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links