Structure of PDB 8htu Chain V

Receptor sequence

>8htuV (length=215) Species: 3218 (Physcomitrium patens) [Search protein sequence]

DSIWYGADRPKYLGPFSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNR
ELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDY
LGNPSLVHAQSILAIWASQVVLMGAVEGYRVAGGPLGEITDPIYPGGSFD
PLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDH
LADPVANNAWAYATN

3D structure

PDB

8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	V	L158 W161	L113 W116
BS02	CHL	V	Y57 L58 G59 Y77 W79	Y12 L13 G14 Y32 W34
BS03	CLA	V	G75 D76 Y77 W79 D80 L84 F91 N94 R95 E98 R218 M221	G30 D31 Y32 W34 D35 L39 F46 N49 R50 E53 R173 M176
BS04	CLA	V	L97 H101	L52 H56
BS05	CLA	V	L107 G111 T114 F125 Q136 Y145 L146	L62 G66 T69 F80 Q91 Y100 L101
BS06	CHL	V	S150 V152 H153 A154	S105 V107 H108 A109
BS07	CHL	V	W104 L143 V152 I160 Q164	W59 L98 V107 I115 Q119
BS08	CHL	V	F131 G134 F138 Q164	F86 G89 F93 Q119
BS09	CHL	V	R103 V171 Y174 R175 G179 L181 G182 I188 P190 F194	R58 V126 Y129 R130 G134 L136 G137 I143 P145 F149
BS10	CHL	V	L97 I100 H101 W104 M168 G169 E172 R175	L52 I55 H56 W59 M123 G124 E127 R130
BS11	CLA	V	R103 L107 Y189 P190 G191 F194 D195 F206 L209 E213	R58 L62 Y144 P145 G146 F149 D150 F161 L164 E168
BS12	CLA	V	W49 K212 K215	W4 K167 K170
BS13	CLA	V	K212 N216 L219	K167 N171 L174
BS14	CLA	V	F222 G226 V229 Q230 N241 H245 A254 Y257	F177 G181 V184 Q185 N196 H200 A209 Y212
BS15	CLA	V	H245 P249 W255	H200 P204 W210
BS16	CHL	V	W255 A258 N260	W210 A213 N215

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum	8htu
PubMed	37474782
UniProt	A9RT62

[Back to BioLiP]