Structure of PDB 8ez5 Chain V

Receptor sequence

>8ez5V (length=137) Species: 197221 (Thermosynechococcus vestitus BP-1)

AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

3D structure

• PDB: 8ez5 Structural evidence for intermediates during O 2 formation in photosystem II.
• Chain: V
• Resolution: 2.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	V	A36 C37 C40 H41 T46 L52 D53 L54 Y75 M76 Y82 H92	A36 C37 C40 H41 T46 L52 D53 L54 Y75 M76 Y82 H92

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009523 photosystem II
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:8ez5, PDBe:8ez5, PDBj:8ez5
• PDBsum: 8ez5
• PubMed: 37138085
• UniProt: P0A386|CY550_THEVB Photosystem II extrinsic protein V (Gene Name=psbV)