Structure of PDB 8evs Chain V

Receptor sequence
>8evsV (length=189) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
REKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMG
KNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNR
VAAPARAGAVAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVS
DVKVVDAGNKVGQSEASLLNLLNISPFTFGLTVVQVYDN
3D structure
PDB8evs Regulation of translation by ribosomal RNA pseudouridylation.
ChainV
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V R5 K7 F12 D31 N32 V33 S34 S35 Q36 H39 R42 R46 L52 M53 G54 K55 N56 T57 M58 R61 G82 N83 R110 R1 K3 F8 D27 N28 V29 S30 S31 Q32 H35 R38 R42 L48 M49 G50 K51 N52 T53 M54 R57 G78 N79 R106
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum8evs
PubMed37595043
UniProtP05317|RLA0_YEAST Large ribosomal subunit protein uL10 (Gene Name=RPP0)

[Back to BioLiP]