Structure of PDB 8cre Chain V

Receptor sequence

>8creV (length=141) Species: 5476 (Candida albicans)

PGVSVRDVPAQDFINAYAQFLQRQGKLEVPGYVDIVKTSAGNDLPPQEAE
TWFYKRAASIARHIYLRKQVGVGALNKLYGGAKNRGFRPHKHVDASGSIN
RKCVQALQKIGVLEISPKGGRRISENGQRDLDRIAAQTLEE

3D structure

• PDB: 8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: V
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	P2 G3 V4 R7 I15 Y33 V37 K38 T39 A41 N43 D44 L45 P47 Q48 R57 S60 R63 H64 K69 G72 V73 G74 K78 G81 A83 K84 N85 G87 F88 R89 P90 H91 H93 S97 G98 S99 R102 Q106 G121 R122 E126 Q129 R130 D133	P1 G2 V3 R6 I14 Y32 V36 K37 T38 A40 N42 D43 L44 P46 Q47 R56 S59 R62 H63 K68 G71 V72 G73 K77 G80 A82 K83 N84 G86 F87 R88 P89 H90 H92 S96 G97 S98 R101 Q105 G120 R121 E125 Q128 R129 D132
BS02	MG	V	N85 H91	N84 H90

External links

• PDB: RCSB:8cre, PDBe:8cre, PDBj:8cre
• PDBsum: 8cre
• UniProt: A0A8H6C5L4